CoraLite®594-conjugated MTH1 Monoclonal antibody

MTH1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-67443
Clone No.2D7G4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

NUDT1, EC:3.6.1.-, 8-oxo-dGTPase, 8 oxo dGTPase, 7,8-dihydro-8-oxoguanine triphosphatase

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67443 targets MTH1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9802

Product name: Recombinant human NUDT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-179 aa of BC014618

Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Predict reactive species
Full Name nudix (nucleoside diphosphate linked moiety X)-type motif 1
Calculated Molecular Weight179aa,20 kDa; 197aa,23 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC014618
Gene Symbol MTH1
Gene ID (NCBI) 4521
RRIDAB_3084766
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP36639
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MTH1, also known as NUDT1 or 8-Oxo-dGTPase, is an important repair enzyme that prevents oxidative stress-induced DNA damage through hydrolyzing mutagenic 8-oxo-dGTP into 8-oxo-dGMP. MTH1 is expressed in postmitotic neurons as well as in proliferative tissues, and it is localized both in the mitochondria and nucleus. MTH1 might be a useful marker of oxidative stress and its level increased upon oxidative stress. Increased expression of MTH1 were also found in various cancer tissues and neurodegenerative diseases.

Protocols

Product Specific Protocols
IF protocol for CL594 MTH1 antibody CL594-67443Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...