• Featured Product
  • KD/KO Validated

USP15 Monoclonal antibody, PBS Only

USP15 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67557-1-PBS
Clone No.1C9G3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

1C9G3, Deubiquitinating enzyme 15, EC:3.4.19.12, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67557-1-PBS targets USP15 as part of a matched antibody pair:

MP51664-1: 67557-1-PBS capture and 67557-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5712

Product name: Recombinant human USP15 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-235 aa of BC020688

Sequence: MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC

Predict reactive species
Full Name ubiquitin specific peptidase 15
Calculated Molecular Weight 112 kDa
Observed Molecular Weight 112 kDa
GenBank Accession NumberBC020688
Gene Symbol USP15
Gene ID (NCBI) 9958
RRIDAB_2882771
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y4E8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ubiquitin is a highly conserved eukaryotic protein that is synthesized as a fusion protein precursor, either to itself or to one of two ribosomal proteins. USP15, is also named as KIAA0529,Unph-2, Unph4, encoding a human ubiquitin-specific protease (USP). The USP15 protein contains the highly conserved Cys and His boxes present in all members of he UBP family of deubiquitinating enzymes(PMID:10444327).It has 3 isoforms produced by alternative splicing.

Loading...
||
New chat

Able

正在加载,请稍候...