Tested Applications
| Positive WB detected in | U2OS cells, HeLa cells, HepG2 cells, HSC-T6 cells, pig brain tissue, HEK-293 cells, K-562 cells, NIH/3T3 cells, Neuro-2a cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse skeletal muscle tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67600-1-Ig targets SDHB in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rabbit |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29868 Product name: Recombinant human SDHB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-280 aa of BC007840 Sequence: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV Predict reactive species |
| Full Name | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 28-32 kDa |
| GenBank Accession Number | BC007840 |
| Gene Symbol | SDHB |
| Gene ID (NCBI) | 6390 |
| RRID | AB_2882806 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P21912 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SDHB(Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial) is also named as SDH, SDH1 and belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. The SDHD, SDHB, and SDHC genes encode subunits of mitochondrial complex II (succinate dehydrogenase). Mitochondrial complex II is a heterotetrameric complex involved in the aerobic electron transport chain and catalyses the oxidation of succinate to fumarate (Krebs cycle) with transport of electrons to the ubiquinone pool. SDHA and SDHB are the hydrophilic catalytic part of the complex and are highly conserved(J Med Genet 2004;41:e99). Defects in SDHB are a cause of susceptibility to pheochromocytoma (PCC), paragangliomas type 4 (PGL4), paraganglioma and gastric stromal sarcoma (PGGSS) and Cowden-like syndrome (CWDLS).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SDHB antibody 67600-1-Ig | Download protocol |
| IHC protocol for SDHB antibody 67600-1-Ig | Download protocol |
| WB protocol for SDHB antibody 67600-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SDHB Monoclonal antibody (1A2A5), catalog number 67600-1-Ig, has 12 citations spanning journals including Nature Communications, Phytomedicine, NPJ Precision Oncology, Journal of Translational Medicine, International Journal of Biological Macromolecules, Phytotherapy Research, Chinese Journal of Natural Medicines, Journal of Ethnopharmacology, CNS Neuroscience & Therapeutics, Cell & Molecular Life Sciences, Biochemical Pharmacology, and BBA – Molecular Basis of Disease. Research fields cover liver and renal fibrosis, paraganglioma, glioma, ovarian failure, thermogenesis, type 2 diabetes, neurotoxicity, nasopharyngeal carcinoma, and mitochondrial oxidative phosphorylation.
| Species | Application | Title |
|---|---|---|
Nat Commun NEK7 couples SDHB to orchestrate respiratory chain electron transport homeostasis that impedes liver fibrosis. | ||
Phytomedicine Zhen Wu decoction represses renal fibrosis by invigorating tubular NRF2 and TFAM to fuel mitochondrial bioenergetics | ||
NPJ Precis Oncol Postnatal sustentacular cells as chromaffin progenitors and tumor cells of origin in VHL-related paragangliomas. | ||
J Transl Med DMC-BH derivative DMC-GF inhibits the growth of glioma stem cells by targeting the TRIM33/SLC25A1/mitochondrial oxidative phosphorylation pathway | ||
Int J Biol Macromol Plasma-derived exosome miR-10a-5p promotes premature ovarian failure by target BDNF via the TrkB/Akt/mTOR signaling pathway | ||
Phytother Res Rutin-activated adipose tissue thermogenesis is correlated with increased intestinal short-chain fatty acid levels. |
Reviews
What customers say
The single review for this product is a 5-star rating for Western Blot on mouse embryonic stem cells. The reviewer used a 1:5000 dilution with overnight primary antibody incubation at 4°C, paired with IRDye 800CW Goat anti-Mouse secondary at 1:15000. The protocol included 4–12% Bis-Tris gradient gel, overnight transfer at 30V/4°C, and SEA Block blocking buffer. The resulting blot clearly resolved bands across whole cell lysate and mitochondrial fraction samples, demonstrating strong and specific detection.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lana (Verified Customer) (08-07-2020) | SDS-PAGE: 20 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:5000.Secondary Ab: IRDye 800CW Goat anti-Mouse, 1:15000.Lines of WB image: 1 – protein ladder, 2 - whole cell lysate, 3 – mitochondrial fraction lysate, 4 – protein ladder.
 |
