Tested Applications
| Positive IHC detected in | human tonsillitis tissue, human colon tissue, human liver tissue, human thymus tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:450-1:1800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67786-1-Ig targets CD4 in IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30870 Product name: Recombinant human CD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-226 aa of BC025782 Sequence: KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLA Predict reactive species |
| Full Name | CD4 molecule |
| Calculated Molecular Weight | 51 kDa |
| GenBank Accession Number | BC025782 |
| Gene Symbol | CD4 |
| Gene ID (NCBI) | 920 |
| ENSEMBL Gene ID | ENSG00000010610 |
| RRID | AB_2918550 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P01730 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells (PMID: 9304802; 12213222). CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It plays an important role in T helper cell development and activation (PMID: 9539765; 3112582). CD4 serves as a receptor for the human immunodeficiency virus (HIV) (PMID: 9304802).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD4 antibody 67786-1-Ig | Download protocol |
| IHC protocol for CD4 antibody 67786-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD4 Monoclonal antibody (catalog #67786-1-Ig) has 147 citations. These appear across journals including Cell Metabolism, Nature Communications, Cell Discovery, Neuron, Advanced Science, Cell Reports, Frontiers in Immunology, Cell Death & Disease, EBioMedicine, and Journal of Neuroinflammation. Research fields span tumor immunology and the tumor microenvironment, cancer immunotherapy (CAR-T, checkpoint inhibitors), autoimmune and inflammatory diseases, neuroinflammation, and infectious disease, with applications mainly in IHC, IF, and ELISA.
| Species | Application | Title |
|---|---|---|
Cell Metab AARS1 promotes tumor progression and immune evasion via ATF6 lactylation-mediated tryptophan metabolism in hepatocellular carcinoma | ||
Cancer Commun (Lond) Targeting autophagy overcomes cancer-intrinsic resistance to CAR-T immunotherapy in B-cell malignancies | ||
Ann Rheum Dis Positive feedback loop PU.1-IL9 in Th9 promotes rheumatoid arthritis development | ||
Cell Mol Immunol Sexual dimorphism of lung immune-regulatory units imprint biased pulmonary fibrosis | ||
Nat Commun Neoadjuvant with low-dose radiotherapy, tislelizumab, albumin-bound paclitaxel, and cisplatin for resectable locally advanced head and neck squamous cell carcinoma: phase II single-arm trial | ||
Nat Commun Single cell transcriptomic analyses implicate an immunosuppressive tumor microenvironment in pancreatic cancer liver metastasis |
Reviews
What customers say
Customers report positive experiences using this antibody for immunofluorescence. One user rated it 5 stars, noting it works well for IF at a 1:100 dilution. Another rated it 4 stars, successfully applying it to FFPE prostate tissue at a 1:50 dilution with Tris-EDTA (pH 9.0) antigen retrieval. Overall, the antibody performs reliably for IF applications across different tissue types and dilutions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (11-26-2025) | works good for IF
|
Emma (Verified Customer) (11-29-2021) | Used for IF on FFPE prostate tissue. Antigen retrieval Tris-EDTA pH 9.0.
|
