Use Able AI chat for product recommendations

IFI16 Monoclonal antibody

IFI16 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67790-1-Ig
Clone No. 1C10D7
Publications (5)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Ifi 16, IFI16, IFNGIP1, PYHIN2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for IFI16 in ?

Tested Applications

Positive WB detected inJurkat cells, HeLa cells, MOLT-4 cells, Ramos cells, Daudi cells
Positive IHC detected inhuman tonsillitis tissue, human renal cell carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67790-1-Ig targets IFI16 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30314

Product name: Recombinant human IFI16 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 580-729 aa of BC017059

Sequence: VCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF

Predict reactive species
Full Name interferon, gamma-inducible protein 16
Calculated Molecular Weight 729 aa, 82 kDa
Observed Molecular Weight85-95 kDa
GenBank Accession NumberBC017059
Gene Symbol IFI16
Gene ID (NCBI) 3428
RRIDAB_2918554
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ16666
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFI16 is a member of a family of interferon-inducible nuclear proteins involved in transcriptional regulation functions as a transcriptional repressor. IFI16 may be involved in TP53-mediated transcriptional activation by enhancing TP53 sequence-specific DNA binding and modulating TP53 phosphorylation status. It has been reported that IFI16 participates in the regulation of autophagy, TP53-mediated cell death and innate immune response. IFI16 has different isoforms and 67790-1-Ig antibody detects proteins around 85-95 kDa in SDS-PAGE similar to papers. (PMID: 9718316, 14990579, 11146555, 22046441)

Protocols

Product Specific Protocols
IF protocol for IFI16 antibody 67790-1-IgDownload protocol
IHC protocol for IFI16 antibody 67790-1-IgDownload protocol
WB protocol for IFI16 antibody 67790-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The IFI16 Monoclonal antibody (1C10D7), catalog number 67790-1-Ig, has 5 total citations. These appear in Nature Communications, Journal of Translational Medicine, Mediators of Inflammation, Journal of Cellular and Molecular Medicine, and BMC Cancer. Research fields span glioblastoma and oncolytic virotherapy, clear cell renal cell carcinoma, neuronal pyroptosis in subarachnoid hemorrhage, cisplatin-induced apoptosis in cervical cancer, and lactate/lactylation networks in acute myeloid leukemia.

SpeciesApplicationTitle
humanWB

Nat Commun

Targeting leucine-rich repeat kinase 2 overcomes resistance to oncolytic herpes simplex virus-based therapies in glioblastoma.

Authors - Yaning Qin
humanWB,IHC

J Transl Med

IFI16 promotes the progression of clear cell renal cell carcinoma through the IL6/PI3K/AKT axis

Authors - Ke Lu
ratWB

Mediators Inflamm

G Protein-Coupled Receptor 30 Attenuates Neuronal Pyroptosis Induced by Subarachnoid Hemorrhage

Authors - Jun Peng
humanWB

J Cell Mol Med

IFI16 Induced by p53 Activates the NF-κB Pathway to Counteract Cisplatin-Induced Apoptosis in Cervical Cancer Cells.

Authors - Lili Zhong
  • KD Validated
humanWB

BMC Cancer

Deciphering lactate/lactylation networks in AML: integrated scRNA-seq and transcriptomics reveal functions and prognostic model.

Authors - Xiaohe Chen
Loading...
||
New chat

Able™

正在加载,请稍候...