IFI16 Monoclonal antibody, PBS Only

• 

  WB analysis using 67790-1-Ig (same clone as 67790-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67790-1-Ig (IFI16 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67790-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67790-1-Ig (same clone as 67790-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67790-1-Ig (IFI16 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67790-1-Ig (same clone as 67790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67790-1-Ig (IFI16 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67790-1-Ig (same clone as 67790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67790-1-Ig (IFI16 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67790-1-Ig (same clone as 67790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67790-1-Ig (IFI16 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 67790-1-Ig (same clone as 67790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 67790-1-Ig (IFI16 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 67790-1-Ig (same clone as 67790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 67790-1-Ig (IFI16 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67790-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67790-1-Ig (same clone as 67790-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using IFI16 antibody (67790-1-Ig, Clone: 1C10D7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67790-1-PBS in a different storage buffer formulation.

IFI16 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67790-1-PBS

Clone No.1C10D7

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Ifi 16, IFI16, IFNGIP1, PYHIN2

---

Product Information

67790-1-PBS targets IFI16 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30314

  Product name: Recombinant human IFI16 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 580-729 aa of BC017059

  Sequence: VCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF

• Full Name: interferon, gamma-inducible protein 16
• Calculated Molecular Weight: 729 aa, 82 kDa
• Observed Molecular Weight: 85-95 kDa
• GenBank Accession Number: BC017059
• Gene Symbol: IFI16
• Gene ID (NCBI): 3428
• RRID: AB_2918554
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16666
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

IFI16 is a member of a family of interferon-inducible nuclear proteins involved in transcriptional regulation functions as a transcriptional repressor. IFI16 may be involved in TP53-mediated transcriptional activation by enhancing TP53 sequence-specific DNA binding and modulating TP53 phosphorylation status. It has been reported that IFI16 participates in the regulation of autophagy, TP53-mediated cell death and innate immune response. IFI16 has different isoforms and 67790-1-Ig antibody detects proteins around 85-95 kDa in SDS-PAGE similar to papers. (PMID: 9718316, 14990579, 11146555, 22046441)