Filter: AllWBIHCFC (Intra)Cytometric bead array sample testCytometric bead array

WB analysis using 67912-1-Ig (same clone as 67912-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67912-1-Ig (PXR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67912-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 67912-1-Ig (same clone as 67912-1-PBS)
MCF-7 cells were subjected to SDS PAGE followed by western blot with 67912-1-Ig (PXR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67912-1-PBS in a different storage buffer formulation.
WB analysis of COLO 320 using 67912-1-Ig (same clone as 67912-1-PBS)
COLO 320 cells were subjected to SDS PAGE followed by western blot with 67912-1-Ig (PXR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67912-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 67912-1-Ig (same clone as 67912-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67912-1-Ig (PXR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67912-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 67912-1-Ig (same clone as 67912-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67912-1-Ig (PXR antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67912-1-PBS in a different storage buffer formulation.
FC experiment of MCF-7 using 67912-1-Ig (same clone as 67912-1-PBS)
1X10^6 MCF-7 cells were intracellularly stained with 0.2 ug Anti-Human PXR (67912-1-Ig, Clone:1G3A7) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67912-1-PBS in a different storage buffer formulation.
×
1X10^6 MCF-7 cells were intracellularly stained with 0.2 ug Anti-Human PXR (67912-1-Ig, Clone:1G3A7) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67912-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP51736-1
Cytometric bead array sample test of MP51736-1, PXR Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67912-1-PBS. Detection antibody: 67912-2-PBS.
Cytometric bead array sample test of MP51736-2
Cytometric bead array sample test of MP51736-2, PXR Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67912-1-PBS. Detection antibody: 67912-4-PBS.
Cytometric bead array standard curve of MP51736-1
Cytometric bead array standard curve of MP51736-1, PXR Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67912-1-PBS. Detection antibody: 67912-2-PBS. Standard:Ag7991. Range: 3.125-400 ng/mL.
Cytometric bead array standard curve of MP51736-2
Cytometric bead array standard curve of MP51736-2, PXR Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67912-1-PBS. Detection antibody: 67912-4-PBS. Standard:Ag7991. Range: 3.125-400 ng/mL.

PXR Monoclonal antibody, PBS Only (Capture)

Name: PXR Monoclonal antibody, PBS Only (Capture)
Brand: Proteintech
SKU: 67912-1-PBS

PXR Monoclonal Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 67912-1-PBS

Clone No.1G3A7

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

NR1I2, 1G3A7, BXR, ONR1, Orphan nuclear receptor PAR1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67912-1-PBS targets PXR as part of a matched antibody pair:

MP51736-1: 67912-1-PBS capture and 67912-2-PBS detection (validated in Cytometric bead array)

MP51736-2: 67912-1-PBS capture and 67912-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag7991 Product name: Recombinant human PXR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 56-433 aa of BC017304 Sequence: MTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS Predict reactive species
Full Name	nuclear receptor subfamily 1, group I, member 2
Calculated Molecular Weight	50 kDa
Observed Molecular Weight	50 kDa
GenBank Accession Number	BC017304
Gene Symbol	PXR
Gene ID (NCBI)	8856
RRID	AB_2918667
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O75469
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Pregnane X receptor (PXR; NR1I2), a member of the nuclear receptor superfamily, plays a key role in the induction of genes involved in drug transport and metabolism. It modulates drug transport and metabolism through the regulation of target genes responsible for the transport and conversion of chemicals into metabolites that are more easily eliminated from the body [PMID: 22609277]. It is also emerging as an endobiotic receptor that regulates the inflammatory response. In addition, PXR acts as a transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds [PMID: 19297428].