PXR Monoclonal antibody

PXR Monoclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 67912-1-Ig
Clone No.1G3A7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, CoIP, ChIP, ELISA

NR1I2, Orphan nuclear receptor PXR, Orphan nuclear receptor PAR1, ONR1, BXR

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat liver tissue, COLO 320 cells, MCF-7 cells, mouse liver tissue
Positive IHC detected inmouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67912-1-Ig targets PXR in WB, IHC, IF, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7991

Product name: Recombinant human PXR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 56-433 aa of BC017304

Sequence: MTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

Predict reactive species
Full Name nuclear receptor subfamily 1, group I, member 2
Calculated Molecular Weight 50 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC017304
Gene Symbol PXR
Gene ID (NCBI) 8856
RRIDAB_2918667
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75469
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pregnane X receptor (PXR; NR1I2), a member of the nuclear receptor superfamily, plays a key role in the induction of genes involved in drug transport and metabolism. It modulates drug transport and metabolism through the regulation of target genes responsible for the transport and conversion of chemicals into metabolites that are more easily eliminated from the body [PMID: 22609277]. It is also emerging as an endobiotic receptor that regulates the inflammatory response. In addition, PXR acts as a transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds [PMID: 19297428].

Protocols

Product Specific Protocols
WB protocol for PXR antibody 67912-1-IgDownload protocol
IHC protocol for PXR antibody 67912-1-IgDownload protocol
FC protocol for PXR antibody 67912-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF,ChIP

Adv Sci (Weinh)

PXR Activation Relieves Deoxynivalenol-Induced Liver Oxidative Stress Via Malat1 LncRNA m6A Demethylation

Authors - Yue Feng
humanWB

Front Pharmacol

Bacteroides dorei BDX-01 alleviates DSS-induced experimental colitis in mice by regulating intestinal bile salt hydrolase activity and the FXR-NLRP3 signaling pathway

Authors - Xiaowei Sun
humanWB,IF,IP

Phytomedicine

Panaxytriol upregulates CYP3A4 expression based on the interaction of PXR, CAR, HSP90α, and RXRα.

Authors - Lingming Zhang
mouseWB

Food Funct

CD36 and DGAT2 facilitate the lipid-lowering effect of chitooligosaccharides via fatty acid intake and triglyceride synthesis signaling.

Authors - Xin Shen
humanIF

J Ethnopharmacol

Panaxytriol upregulates CYP3A4 expression through the interaction between nuclear regulators and DNA response elements

Authors - Jingdi Yan
mouseWB

Part Fibre Toxicol

Type 1 diabetes and diet-induced obesity predispose C57BL/6J mice to PM2.5-induced lung injury: a comparative study

Authors - Shen Chen
Loading...
||
New chat Able
正在加载,请稍候...