Tested Applications
| Positive WB detected in | HepG2 cells, HL-60 cells, HSC-T6 cells, NIH/3T3 cells, pig spleen tissue, rabbit spleen tissue, Jurkat cells, Raji cells, K-562 cells |
| Positive IHC detected in | human liver tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse liver tissue |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67969-1-Ig targets MYD88 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27659 Product name: Recombinant human MYD88 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-296 aa of BC013589 Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP Predict reactive species |
| Full Name | myeloid differentiation primary response gene (88) |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC013589 |
| Gene Symbol | MYD88 |
| Gene ID (NCBI) | 4615 |
| RRID | AB_2918720 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q99836 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MYD88 is a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. MYD88 is the key adaptor protein for the interleukin-1 receptor (IL-1R) and most Toll-like receptors (TLRs), which are essential for innate immunity and pathogen-associated molecular pattern recognition. Mutations in the MyD88 gene lead to the development of cancer in humans and mice suggesting that MyD88 also plays a cell autonomous role in tissue homeostasis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MYD88 antibody 67969-1-Ig | Download protocol |
| IHC protocol for MYD88 antibody 67969-1-Ig | Download protocol |
| WB protocol for MYD88 antibody 67969-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MYD88 Monoclonal antibody (Cat# 67969-1-Ig) has accumulated 153 citations across journals including Nature Communications, Cell Reports, Gut Microbes, Phytomedicine, Frontiers in Immunology, International Journal of Molecular Sciences, Journal of Ethnopharmacology, Theranostics, Microbiome, and Developmental Cell. Research fields encompass innate immunity and TLR4/MyD88/NF-κB signaling, neuroinflammation, gut microbiota modulation, liver disease, cardiovascular pathology, oncology, pulmonary and renal injury, traditional Chinese medicine pharmacology, and nanomedicine-based therapeutics.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Innovative peptide-loaded hybrid membrane nanovaccine enables precise personalized immunotherapy for HPV-related cervical diseases. | ||
Nat Commun Released palmitic acid-mediated TLR4/NF-κB activation enhances the virulence of Bordetella pertussis MT28 lineage. | ||
Gut Microbes Probiotic Lactobacillus casei improves immune microenvironment in rheumatoid arthritis via gut microbiota-butyrate-HDAC/NF-κB signaling. | ||
Gut Microbes High-fat diet-induced L-saccharopine accumulation inhibits estradiol synthesis and damages oocyte quality by disturbing mitochondrial homeostasis | ||
J Nanobiotechnology Melanin-like polydopamine nanoparticles mediating anti-inflammatory and rescuing synaptic loss for inflammatory depression therapy | ||
Theranostics Deciphering m6A methylation in monocyte-mediated cardiac fibrosis and monocyte-hitchhiked erythrocyte microvesicle biohybrid therapy |
