• Featured Product
  • KD/KO Validated

SFXN1 Monoclonal antibody, PBS Only (Capture)

SFXN1 Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 68024-1-PBS
Clone No.2D9F1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

2D9F1, sideroflexin 1, Sideroflexin-1, TCC, Tricarboxylate carrier protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68024-1-PBS targets SFXN1 as part of a matched antibody pair:

MP50630-2: 68024-1-PBS capture and 68024-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2985

Product name: Recombinant human SFXN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-236 aa of BC020517

Sequence: MILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL

Predict reactive species
Full Name sideroflexin 1
Calculated Molecular Weight35.6 kDa
Observed Molecular Weight32 kDa
GenBank Accession NumberBC020517
Gene Symbol SFXN1
Gene ID (NCBI) 94081
RRIDAB_2918768
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9H9B4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SFXN1, the founding member of the SLC56 family, was identified by positional cloning of the mutation in the flexed-tail mouse model with sideroblastic anemia. SFXN1 was recently identified as a mitochondrial serine transporter essential for one-carbon (1C) metabolism, a process in which folate species are generated and used in biosynthetic pathways required for cell proliferation. In HEK293 cells, SFXN1 is the most abundant isoform among the SFXNs.

Loading...
||
New chat Able
正在加载,请稍候...