Tested Applications
| Positive WB detected in | Transfected HEK-293 cells |
| Positive IF/ICC detected in | Transfected HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68088-1-Ig targets mCherry in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with recombinant protein samples.
| Tested Reactivity | recombinant protein |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25320 Product name: Recombinant mCherry protein Source: e coli.-derived, PGEX-4T Tag: GST Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Predict reactive species |
| Full Name | mCherry |
| Calculated Molecular Weight | 27 kDa |
| Gene Symbol | |
| Gene ID (NCBI) | |
| RRID | AB_2918825 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
mCherry is a fluorophore (a fluorescent protein) used in biotechnology as a tracer to follow the flow of fluids, as a marker when tagged to molecules and cell components. mCherry is the second generation monomeric red fluorescent protein that have improved brightness and photostability. mCherry and the majority of red fluorescent proteins derive from a protein isolated from Discosoma sp. mCherry is a monomeric fluorescent construct with peak absorption/emission at 587 nm and 610 nm, respectively.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for mCherry antibody 68088-1-Ig | Download protocol |
| WB protocol for mCherry antibody 68088-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The mCherry Monoclonal antibody (1B3C6), catalog number 68088-1-Ig, has 33 citations spanning 26 journals including Cell, Nature Cell Biology, Nature Communications, Cell Research, Autophagy, ACS Nano, Nucleic Acids Research, Science Advances, Plant Cell, New Phytologist, EMBO Reports, Journal of Virology, and Journal of Biological Chemistry. Research fields covered include lysosomal biology, autophagy, viral replication, plant immunity, neuroscience, cancer immunotherapy, protein folding, DNA repair, iron homeostasis, and rare diseases.
| Species | Application | Title |
|---|---|---|
Cell An organ-conformal, kirigami-structured bioelectronic patch for precise intracellular delivery. | ||
Cell Res Repair of damaged lysosomes by TECPR1-mediated membrane tubulation during energy crisis. | ||
Autophagy A CRISPR-Cas9 screen identifies LAPTM4A (lysosomal protein transmembrane 4 alpha) as a key host barrier against PRRSV infection. | ||
Nat Commun Pharmacologic inhibition of PCBP2 biomolecular condensates relieves Alzheimer's disease | ||
ACS Nano Nose-to-Brain Delivery of mRNA-Loaded Lipid Nanoparticles Bypasses the Blood-Brain Barrier for Effective Brain Disease Therapy. |
Reviews
What customers say
Users report mixed results for this antibody in Western blot applications. One reviewer found it produced a very clear and strong signal at 1:5,000 dilution in neuronal cells. Another reviewer, using it to detect an mCherry-tagged protein in HEK293T cells, confirmed it works but noted it was less sensitive than their previous in-house antibody, with some bands of the protein of interest not clearly detected. Increasing concentration from 1:5,000 to 1:1,000 did not improve sensitivity. Overall, the antibody is functional but may lack the sensitivity needed for lower-abundance targets.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Olga (Verified Customer) (04-09-2025) | Very clear and strong signal in Western blot.
 |
Christine (Verified Customer) (10-02-2024) | We are running out of a home-made sheep anti RFP antibody and trying to find a replacement. I ran samples transfected with a mCHERRY-tagged protein side by side to compare our old antibody and this one. Although I detected clearly the expression of the mCHERRY tagged protein with this antibody, it was not as sensitive as the sheep one we had and there were some bands of my protein of interest that I could not detect clearly. Upping the concentration from 1:5,000 to 1:1,000 did not make any clear difference. So although the antibody works it is not sensitive enough for my needs.
|
