ENOPH1 Monoclonal antibody, PBS Only (Capture)

ENOPH1 Monoclonal Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 68179-1-PBS
Clone No.1F1E11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

MASA, 1F1E11, 2,3-diketo-5-methylthio-1-phosphopentane phosphatase, E1, EC:3.1.3.77

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68179-1-PBS targets ENOPH1 as part of a matched antibody pair:

MP50127-1: 68179-1-PBS capture and 68179-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12553

Product name: Recombinant human ENOPH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-261 aa of BC065815

Sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST

Predict reactive species
Full Name enolase-phosphatase 1
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight29-35 kDa
GenBank Accession NumberBC065815
Gene Symbol ENOPH1
Gene ID (NCBI) 58478
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UHY7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa.

Loading...
||
New chat Able
正在加载,请稍候...