ENOPH1 Monoclonal antibody

ENOPH1 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 68179-1-Ig
Clone No.1F1E11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, FC (Intra), ELISA

MASA, 1F1E11, 2,3-diketo-5-methylthio-1-phosphopentane phosphatase, E1, EC:3.1.3.77

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68179-1-Ig targets ENOPH1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12553

Product name: Recombinant human ENOPH1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-261 aa of BC065815

Sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST

Predict reactive species
Full Name enolase-phosphatase 1
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight29-35 kDa
GenBank Accession NumberBC065815
Gene Symbol ENOPH1
Gene ID (NCBI) 58478
RRIDAB_2935270
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UHY7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa.

Protocols

Product Specific Protocols
FC protocol for ENOPH1 antibody 68179-1-IgDownload protocol
WB protocol for ENOPH1 antibody 68179-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...