ENOPH1 Monoclonal antibody

• 

  WB analysis using 68179-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68179-1-Ig (ENOPH1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control.

• 

  FC experiment of HepG2 using 68179-1-Ig

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug ENOPH1 Monoclonal antibody (68179-1-Ig, Clone:1F1E11) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

ENOPH1 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 68179-1-Ig

Clone No.1F1E11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, FC (Intra), ELISA

Synonyms

MASA, 1F1E11, 2,3-diketo-5-methylthio-1-phosphopentane phosphatase, E1, EC:3.1.3.77

---

Tested Applications

• Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68179-1-Ig targets ENOPH1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12553

  Product name: Recombinant human ENOPH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-261 aa of BC065815

  Sequence: MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST

• Full Name: enolase-phosphatase 1
• Calculated Molecular Weight: 261 aa, 29 kDa
• Observed Molecular Weight: 29-35 kDa
• GenBank Accession Number: BC065815
• Gene Symbol: ENOPH1
• Gene ID (NCBI): 58478
• RRID: AB_2935270
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UHY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ENOPH1, also named as MASA and MSTP145, belongs to the HAD-like hydrolase superfamily and MasA/MtnC family. ENOPH1 is a newly identified enzyme involved in L-methionine biosynthesis, which is associated with anxiety and depression. Studies have shown that ENOPH1 plays a crucial role in promoting the proliferation and migration of glioma cells (PMID: 32654229). ENOPH1 has 2 isoforms with the molecular mass of 13 and 29 kDa.