DNM2 Monoclonal antibody

DNM2 Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 68209-1-Ig
Clone No.1B8H3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, ELISA

1B8H3, DNM 2, DYN2, dynamin 2, Dynamin II

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68209-1-Ig targets DNM2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6274

Product name: Recombinant human DNM2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 518-866 aa of BC054501

Sequence: RRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD

Predict reactive species
Full Name dynamin 2
Calculated Molecular Weight 98 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC054501
Gene Symbol DNM2
Gene ID (NCBI) 1785
RRIDAB_2935297
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP50570
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNM2, also known as DYN2, DYNII, CMTDI1, CMTDIB, belongs to the dynamin family. DNM2 is a ubiquitously expressed large GTPase involved in clathrin-dependent and -independent endocytosis and intracellular membrane trafficking. DNM2 plays a role in the regulation of neuron morphology, axon growth, and the formation of neuronal growth cones. Dynamins are associated with microtubules. DNM2 plays an important role in endocytosis and is involved in cytokinesis (PMID: 33713620, 12498685). Mutations in DNM2 cause dominant centronuclear myopathy (PMID: 16227997). Defects in DNM2 are the cause of Charcot-Marie-Tooth disease dominant intermediate type B (CMTDIB) (PMID: 15731758). Alternate splicing results in multiple transcript variants.

Protocols

Product Specific Protocols
IF protocol for DNM2 antibody 68209-1-IgDownload protocol
WB protocol for DNM2 antibody 68209-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...