DNM2 Monoclonal antibody, PBS Only (Capture)

DNM2 Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 68209-1-PBS
Clone No.1B8H3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

1B8H3, DNM 2, DYN2, dynamin 2, Dynamin II

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68209-1-PBS targets DNM2 as part of a matched antibody pair:

MP50954-1: 68209-1-PBS capture and 68209-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6274

Product name: Recombinant human DNM2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 518-866 aa of BC054501

Sequence: RRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD

Predict reactive species
Full Name dynamin 2
Calculated Molecular Weight 98 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC054501
Gene Symbol DNM2
Gene ID (NCBI) 1785
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP50570
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DNM2, also known as DYN2, DYNII, CMTDI1, CMTDIB, belongs to the dynamin family. DNM2 is a ubiquitously expressed large GTPase involved in clathrin-dependent and -independent endocytosis and intracellular membrane trafficking. DNM2 plays a role in the regulation of neuron morphology, axon growth, and the formation of neuronal growth cones. Dynamins are associated with microtubules. DNM2 plays an important role in endocytosis and is involved in cytokinesis (PMID: 33713620, 12498685). Mutations in DNM2 cause dominant centronuclear myopathy (PMID: 16227997). Defects in DNM2 are the cause of Charcot-Marie-Tooth disease dominant intermediate type B (CMTDIB) (PMID: 15731758). Alternate splicing results in multiple transcript variants.

Loading...
||
New chat

Able

正在加载,请稍候...