Integrin alpha 1/CD49a Monoclonal antibody, PBS Only (Detector)

Integrin alpha 1/CD49a Monoclonal Antibody for WB, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 68211-1-PBS
Clone No.1C4F2

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IF-P, Cytometric bead array, Indirect ELISA

ITGA1, 1C4F2, CD49 antigen-like family member A, CD49a, Integrin alpha 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68211-1-PBS targets Integrin alpha 1/CD49a as part of a matched antibody pair:

MP50423-3: 68211-4-PBS capture and 68211-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30631

Product name: Recombinant human Integrin alpha-1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 980-1141 aa of BC137121

Sequence: GNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDISQVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRVP

Predict reactive species
Full Name integrin, alpha 1
Calculated Molecular Weight 1179 aa, 131 kDa
Observed Molecular Weight180 kDa
GenBank Accession NumberBC137121
Gene Symbol Integrin alpha 1
Gene ID (NCBI) 3672
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56199
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha-1 (ITGA1, CD49a) combines with the beta 1 subunit (ITGB1, CD29) to form a cell-surface receptor for collagen and laminin. This receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. Integrin alpha-1 is a transmembrane glycoprotein with an apparent molecular weight of 180-250 kDa, larger than the calculated molecular weight of 131 kDa (PMID: 2475259; 3257425; 11557277; 18840653).

Loading...
||
New chat

Able

正在加载,请稍候...