• Featured Product
  • KD/KO Validated

IMMT Monoclonal antibody, PBS Only (Capture/Detector)

IMMT Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 68226-1-PBS
Clone No.2D2E8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

2D2E8, Cell proliferation-inducing gene 4/52 protein, HMP, MIC60, MICOS complex subunit MIC60

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68226-1-PBS targets IMMT as part of a matched antibody pair:

MP50515-1: 68226-1-PBS capture and 68226-2-PBS detection (validated in Cytometric bead array)

MP50515-2: 68226-3-PBS capture and 68226-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0102

Product name: Recombinant human IMMT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4-297 aa of BC002412

Sequence: ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK

Predict reactive species
Full Name inner membrane protein, mitochondrial (mitofilin)
Calculated Molecular Weight 90 kDa
Observed Molecular Weight90 kDa
GenBank Accession NumberBC002412
Gene Symbol IMMT
Gene ID (NCBI) 10989
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16891
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

IMMT (also known as mitofilin) is an inner mitochondrial membrane protein that is preferentially expressed in heart tissue and is commonly used as the marker for mitochondria. Mitofilin is known to be a critical organizer of mitochondrial cristae morphology and is indispensable for normal mitochondrial function. Three isoforms of mitofilin exist due to the alternative splicing. All three proteins of 87kD, 89kD and 80kD can be detected in immunoblot analysis with this antibody.

Loading...
||
New chat Able
正在加载,请稍候...