Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CC2D1A Monoclonal antibody, PBS Only (Capture)

CC2D1A Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 68334-1-PBS
Clone No.1C11G2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

FREUD 1, AKI1, Akt kinase-interacting protein 1, Coiled-coil and C2 domain-containing protein 1A, Five prime repressor element under dual repression-binding protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68334-1-PBS targets CC2D1A as part of a matched antibody pair:

MP51793-1: 68334-1-PBS capture and 68334-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10363

Product name: Recombinant human CC2D1A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-351 aa of BC064981

Sequence: MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPMEAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTLQERLALYQTAIESARQAGDSAKMRRYDRGLKTLENLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPAPTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDTTAAARHFRVAKSFDAVLEALSRGEPVDLSCLPPPPDQLPPDPPSPPSQPPTPATAPSTTEVPPPPRTLLEA

Predict reactive species
Full Name coiled-coil and C2 domain containing 1A
Calculated Molecular Weight 951 aa, 104 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC064981
Gene Symbol CC2D1A
Gene ID (NCBI) 54862
RRIDAB_3085058
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ6P1N0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CC2D1A (coiled-coil and C2 domain-containing 1A), also known as Freud-1, Aki1 or TAPE (TBK1-associated protein in endolysosomes), is a evolutionary conserved protein located in different subcellular compartments, including the nucleus, centrosome, and endolysosomes. It acts as a scaffold protein that interacts with various proteins and plays diverse biological roles. Mutations in CC2D1A have been linked to nonsyndromic mental retardation (NMSR) and generate a truncated 85-kDa product. Several isoforms of CC2D1A proteins have also been described: 120 /130-kDa doublet of long isoform and 67 kDa short isoform. The short isoform of CC2D1A has been identified as the predominant isoform in rodent cells, while the long isoform is more abundant in human cells. Recently it has been reported that CC2D1A/TAPE is the first innate immune regulator implicated in both TLR and RLR signaling at a very early step.

Loading...
||
New chat

Able

正在加载,请稍候...