DICER1 Monoclonal antibody

DICER1 Monoclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 68375-1-Ig
Clone No.1C8E2

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

WB, IF/ICC, IP, ELISA

DCR1, Dicer, dicer 1, ribonuclease type III, DICER1, Endoribonuclease Dicer, Helicase MOI, Helicase with RNase motif, HERNA, KIAA0928

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells, Ramos cells, Sp2/0 cells
Positive IP detected inJurkat cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68375-1-Ig targets DICER1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30368

Product name: Recombinant human DICER1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 432-534 aa of NM_030621

Sequence: TNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLV

Predict reactive species
Full Name dicer 1, ribonuclease type III
Calculated Molecular Weight 219 kDa
Observed Molecular Weight240-250 kDa
GenBank Accession NumberNM_030621
Gene Symbol DICER1
Gene ID (NCBI) 23405
RRIDAB_3085094
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UPY3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DICER1 functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. DICER1 cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, and producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation.

Protocols

Product Specific Protocols
IF protocol for DICER1 antibody 68375-1-IgDownload protocol
IP protocol for DICER1 antibody 68375-1-IgDownload protocol
WB protocol for DICER1 antibody 68375-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Aleksandr (Verified Customer) (11-10-2024)

Great antibody, that were used to probe for Dicer1 in human RKO cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: RKO
DICER1 Antibody Western Blot validation (1:2000 dilution) in RKO (Cat no:68375-1-Ig)
FH

Tsimafei (Verified Customer) (08-07-2024)

Excellent antibody for Dicer1

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mESCs
DICER1 Antibody Western Blot validation (1:3000 dilution) in mESCs (Cat no:68375-1-Ig)
FH

Laurens (Verified Customer) (08-01-2023)

Antibody worked excellently on western blot. On par or even better than the D38E7 antibody from Cell Signalling, despite using a lower dilution of the Proteintech antibody. Will turn out to be a cheaper and better alternative.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HEK293
DICER1 Antibody Western Blot validation (1:2000 dilution) in HEK293 (Cat no:68375-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...