HDAC5 Monoclonal antibody

HDAC5 Monoclonal Antibody for WB, ELISA
Cat No. 68437-1-Ig
Clone No.1B9E6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, ELISA

Antigen NY CO 9, FLJ90614, HD5, HDAC5, histone deacetylase 5, KIAA0600, NY CO 9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSaos-2 cells, COLO 320 cells, HeLa cells, T-47D cells, SK-BR-3 cells, A2780 cells, HepG2 cells, HSC-T6 cells, 4T1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68437-1-Ig targets HDAC5 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30557

Product name: Recombinant human HDAC5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 371-513 aa of NM_005474

Sequence: NISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVM

Predict reactive species
Full Name histone deacetylase 5
Calculated Molecular Weight 122 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberNM_005474
Gene Symbol HDAC5
Gene ID (NCBI) 10014
RRIDAB_3085150
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UQL6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone acetylation and deacetylation alternately exposes and occludes DNA to transcription factors. At least 4 classes of HDAC were identified. HDAC5 is a class II HDAC. HDAC5 responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC5 is involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, HDAC5 shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors.

Protocols

Product Specific Protocols
WB protocol for HDAC5 antibody 68437-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...