HDAC5 Monoclonal antibody, PBS Only

HDAC5 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 68437-1-PBS
Clone No.1B9E6

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, Indirect ELISA

Antigen NY CO 9, FLJ90614, HD5, HDAC5, histone deacetylase 5, KIAA0600, NY CO 9

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68437-1-PBS targets HDAC5 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30557

Product name: Recombinant human HDAC5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 371-513 aa of NM_005474

Sequence: NISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATSMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVM

Predict reactive species
Full Name histone deacetylase 5
Calculated Molecular Weight 122 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberNM_005474
Gene Symbol HDAC5
Gene ID (NCBI) 10014
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UQL6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Histone acetylation and deacetylation alternately exposes and occludes DNA to transcription factors. At least 4 classes of HDAC were identified. HDAC5 is a class II HDAC. HDAC5 responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC5 is involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, HDAC5 shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors.

Loading...
||
New chat Able
正在加载,请稍候...