STEAP4 Monoclonal antibody

STEAP4 Monoclonal Antibody for WB, ELISA

Cat No. 68465-1-Ig

Clone No. 2A12G6

Publications (1)

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA
For FC, select conjugated version.

Synonyms

2A12G6, EC:1.16.1.-, Metalloreductase STEAP4, Six-transmembrane epithelial antigen of prostate 4, STAMP2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 68465-1-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 68465-1-Ig (STEAP4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 68465-1-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 68465-1-Ig (STEAP4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse lung using 68465-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 68465-1-Ig (STEAP4 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 68465-1-Ig
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68465-1-Ig (STEAP4 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 68465-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68465-1-Ig (STEAP4 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for STEAP4 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

A549 cells, rat liver tissue, HaCaT cells, HeLa cells, MDA-MB-468 cells, SK-BR-3 cells, mouse liver tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68465-1-Ig targets STEAP4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag30137 Product name: Recombinant human STEAP4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-110 aa of BC020600 Sequence: MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKI Predict reactive species
Full Name	STEAP family member 4
Calculated Molecular Weight	52 kDa
Observed Molecular Weight	52 kDa
GenBank Accession Number	BC020600
Gene Symbol	STEAP4
Gene ID (NCBI)	79689
RRID	AB_3085176
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q687X5
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STEAP4 (also called STAMP2), is a member of the STEAP family. Structurally, It is a 459 amino acid protein characterized by a molecular topology of six transmembrane domains. The cytoplasmic N-terminal domain of STEAP4 shows structural similarity with bacterial and archaeal FNO oxidoreductase and STEAP4 exhibits a strong iron reductase activity. Studies in mice and human suggest that STEAP4 maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression.

Protocols

Product Specific Protocols
FC protocol for STEAP4 antibody 68465-1-Ig	Download protocol
WB protocol for STEAP4 antibody 68465-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The STEAP4 Monoclonal antibody (2A12G6), catalog number 68465-1-Ig, has a total of 1 citation. This citation appears in Journal of Hazardous Materials (Impact Factor 10.6), published in 2026. The study investigated Cu(OH)₂ nanopesticide-induced adolescent social behavior deficits mediated by long noncoding RNA and synaptic network dysfunction in mice, using the antibody for Western blot. The research falls within the fields of environmental toxicology and neuroscience.

Species	Application	Title
mouse	WB	J Hazard Mater Cu(OH)(2) nanopesticide induced adolescent social behavior deficits via long noncoding RNA-mediated synaptic network dysfunction. Authors - Zhihua Ren View Article