Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

FLAD1 Monoclonal antibody, PBS Only (Detector)

FLAD1 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 68491-1-PBS
Clone No.1F9A8

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

1F9A8, EC:2.7.7.2, FAD pyrophosphorylase, FAD synthase, FAD synthase region

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68491-1-PBS targets FLAD1 as part of a matched antibody pair:

MP50710-5: 68491-7-PBS capture and 68491-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6845

Product name: Recombinant human FLAD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 148-447 aa of BC011378

Sequence: LVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRG

Predict reactive species
Full Name FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)
Calculated Molecular Weight 446 aa, 49 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC011378
Gene Symbol FLAD1
Gene ID (NCBI) 80308
RRIDAB_3085202
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8NFF5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FLAD1 is a protein-coding gene for flavin adenine dinucleotide synthetase (FADS), a key enzyme in the FAD biosynthesis process which contains an N-terminal molybdopterin -binding (MPTb) domain and a C-terminal domain (FADS domain) (PMID: 32714079). Alternative splicing of the human FLAD1 gene generates different isoforms of the enzyme FAD synthase. ~60 and ~50 kDa bands correspond to the expected mitochondrial FADS1 and cytosolic FADS2 proteins, respectively (PMID: 29316637).

Loading...
||
New chat

Able

正在加载,请稍候...