DSG2 Monoclonal antibody, PBS Only (Capture)

DSG2 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 68515-1-PBS
Clone No.1B8C3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

ARVC10, ARVD10, Cadherin family member 5, CDHF5, Desmoglein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68515-1-PBS targets DSG2 as part of a matched antibody pair:

MP51241-1: 68515-1-PBS capture and 68515-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20633

Product name: Recombinant human DSG2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 345-608 aa of BC099655

Sequence: MKNLDFSVIVANKAAFHKSIRSKYKPTPIPIKVKVKNVKEGIHFKSSVISIYVSESMDRSSKGQIIGNFQAFDEDTGLPAHARYVKLEDRDNWISVDSVTSEIKLAKLPDFESRYVQNGTYTVKIVAISEDYPRKTITGTVLINVEDINDNCPTLIEPVQTICHDAEYVNVTAEDLDGHPNSGPFSFSVIDKPPGMAEKWKIARQESTSVLLQQSEKKLGRSEIQFLISDNQGFSCPEKQVLTLTVCECLHGSGCREAQHDSYV

Predict reactive species
Full Name desmoglein 2
Calculated Molecular Weight 1118 aa, 122 kDa
Observed Molecular Weight145-150 kDa
GenBank Accession NumberBC099655
Gene Symbol DSG2
Gene ID (NCBI) 1829
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14126
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. Desmosomal cadherins, consisting of four desmogleins (DSG1-4) and three desmocollins (DSC1-3) in humans, mediate adhesion through calcium-dependent homophilic/heterophilic interactions. DSG2 is a single-pass transmembrane glycoprotein that is widely expressed in epithelial and non-epithelial tissues, such as the intestine, epidermis, testis, and heart (PMID:21715983). Defects in DSG2 are the cause of familial arrhythmogenic right ventricular dysplasia type 10 (ARVD10), and genetic variations in DSG2 are the cause of susceptibility to cardiomyopathy dilated type 1BB (CMD1BB).

Loading...
||
New chat

Able

正在加载,请稍候...