Tested Applications
| Positive WB detected in | Karpas-299 cells, MDA-MB-231 cells, NCI-H1299 cells, SCaBER cells, A431 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68640-1-Ig targets cGAS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30074 Product name: Recombinant human C6orf150 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 322-433 aa of BC113608 Sequence: LALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKF Predict reactive species |
| Full Name | chromosome 6 open reading frame 150 |
| Calculated Molecular Weight | 496 aa, 54 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC113608 |
| Gene Symbol | cGAS |
| Gene ID (NCBI) | 115004 |
| RRID | AB_3085328 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q8N884 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
cGAS (Cyclic GMP-AMP synthase), also known as C6orf150 or h-cGAS, is a 522 aa protein. cGAS mediates innate immune responses against invading pathogens, or against self-dsDNA, which causes autoimmune disorders. The cGAS sensor not only recognizes cytosolic dsDNA but also synthesizes the second messenger cGAMP from ATP and GTP, which then binds to and activates STING. STING undergoes conformational changes and translocation from the endoplasmic reticulum to the Golgi apparatus to encounter TBK1 and IRF3, eventually triggering the production of type I IFNs.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for cGAS antibody 68640-1-Ig | Download protocol |
| WB protocol for cGAS antibody 68640-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Environ Pollut Disturbance of Mitochondrial Dynamics Led to Spermatogenesis Disorder in Mice Exposed to Polystyrene Micro- and Nanoplastics | ||
Antioxidants (Basel) Hyperosmolarity-Induced Oxidative Stress Leads to Senescence in Human Corneal Epithelial Cells (HCEPC) via DNA Damage, Metabolic Disturbance and Mitophagy Decline. | ||
PLoS Pathog The tegument protein VP22 of pseudorabies virus inhibits cGAS condensation by inducing nuclear-to-cytoplasmic translocation of DDX21 | ||
Adv Healthc Mater Bio-orthogonal Chemistry-Facilitated Zn-Mn Double-Layered Nanobombs Abrogate cGAS-STING Evasion of Tumor Cells. | ||
Phytomedicine NOX2 inhibitor baicalein alleviates rheumatoid arthritis and inactivating mitochondrial oxidative stress-mediated cGAS-STING signaling in fibroblast-like synoviocytes. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alicia (Verified Customer) (11-20-2025) | I used it on microglia derived from human ipsc. It works well !
|
