CD86 Monoclonal antibody, PBS Only (Detector)

CD86 Monoclonal Antibody for WB, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 68674-2-PBS
Clone No.1D6H7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA, Sample test

1D6H7, Activation B7 2 antigen, Activation B7-2 antigen, B7 2, B70

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68674-2-PBS targets CD86 as part of a matched antibody pair:

MP50056-1: 68674-1-PBS capture and 68674-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Eg0059

Product name: Recombinant Human B7-2/CD86 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 26-247 aa of NM_175862

Sequence: LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Predict reactive species
Full Name CD86 molecule
Calculated Molecular Weight 329 aa, 38 kDa
GenBank Accession NumberNM_175862
Gene Symbol CD86
Gene ID (NCBI) 942
ENSEMBL Gene IDENSG00000114013
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP42081
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response.

Loading...
||
New chat

Able

正在加载,请稍候...