GDF-15 Monoclonal antibody

GDF-15 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 68768-1-Ig
Clone No.1B1H4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

GDF15, 1B1H4, GDF 15, growth differentiation factor 15, Growth/differentiation factor 15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, Caki-1 cells, HepG2 cells, LNCaP cells, HT-29 cells, human placenta tissue
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68768-1-Ig targets GDF-15 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33750

Product name: Recombinant human GDF15 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 30-308 aa of BC008962

Sequence: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Predict reactive species
Full Name growth differentiation factor 15
Calculated Molecular Weight 34 kDa
Observed Molecular Weight34 kDa
GenBank Accession NumberBC008962
Gene Symbol GDF15
Gene ID (NCBI) 9518
RRIDAB_3670423
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99988
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Growth differentiation factor 15 (GDF15), also known as macrophage inhibitory cytokine-1 (MIC-1), is a protein of the transforming growth factor beta (TGFb) superfamily that regulates inflammatory and apoptotic pathways in injured tissues and during disease processes. GDF15 is a stress-induced cytokine and associated with hypoxia, inflammation and oxidative stress, it is also released from endothelial cells after stimulation with pro-inflammatory cytokines. GDF15 has been suggested as a target and biomarker for cardiovascular disease as it plays a cardioprotective role in the adult heart. GDF15 is highly expressed in the placenta. GDF15 is known to be involved in human embryo development and necessary for the maintenance of pregnancy. GDF15 is also produced by adipocytes in response to oxidative stress, a well-known factor associated with preeclampsia.

Protocols

Product Specific Protocols
IF protocol for GDF-15 antibody 68768-1-IgDownload protocol
IHC protocol for GDF-15 antibody 68768-1-IgDownload protocol
WB protocol for GDF-15 antibody 68768-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...