GDF-15 Monoclonal antibody, PBS Only (Detector)

GDF-15 Monoclonal Antibody for WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA
Cat No. 68768-1-PBS
Clone No.1B1H4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA

GDF15, 1B1H4, GDF 15, growth differentiation factor 15, Growth/differentiation factor 15

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68768-1-PBS targets GDF-15 as part of a matched antibody pair:

MP50133-1: 68768-3-PBS capture and 68768-1-PBS detection (validated in Sandwich ELISA)

MP50133-2: 68768-4-PBS capture and 68768-1-PBS detection (validated in Sandwich ELISA)

MP50133-9: 68768-6-PBS capture and 68768-1-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33750

Product name: Recombinant human GDF15 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 30-308 aa of BC008962

Sequence: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Predict reactive species
Full Name growth differentiation factor 15
Calculated Molecular Weight 34 kDa
Observed Molecular Weight34 kDa
GenBank Accession NumberBC008962
Gene Symbol GDF15
Gene ID (NCBI) 9518
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99988
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Growth differentiation factor 15 (GDF15), also known as macrophage inhibitory cytokine-1 (MIC-1), is a protein of the transforming growth factor beta (TGFb) superfamily that regulates inflammatory and apoptotic pathways in injured tissues and during disease processes. GDF15 is a stress-induced cytokine and associated with hypoxia, inflammation and oxidative stress, it is also released from endothelial cells after stimulation with pro-inflammatory cytokines. GDF15 has been suggested as a target and biomarker for cardiovascular disease as it plays a cardioprotective role in the adult heart. GDF15 is highly expressed in the placenta. GDF15 is known to be involved in human embryo development and necessary for the maintenance of pregnancy. GDF15 is also produced by adipocytes in response to oxidative stress, a well-known factor associated with preeclampsia.

Loading...
||
New chat

Able

正在加载,请稍候...