ACE2 Recombinant monoclonal antibody

ACE2 Uni-rAb® Recombinant Antibody for IHC, IF-P, ELISA
Cat No. 80063-1-RR
Clone No.4H12

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

IHC, IF-P, ELISA

ACE related carboxypeptidase, ACE2, ACEH, DKFZp434A014, Metalloprotease MPROT15

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman kidney tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:800-1:3200
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80063-1-RR targets ACE2 in IHC, IF-P, ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30683

Product name: Recombinant human ACE2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 30-356 aa of BC048094

Sequence: DKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDF

Predict reactive species
Full Name angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Calculated Molecular Weight 805 aa, 92 kDa
GenBank Accession NumberBC048094
Gene Symbol ACE2
Gene ID (NCBI) 59272
RRIDAB_2918860
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BYF1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2. The location of ACE2 is membrane and cytoplasm, however it accumulates in the nucleus during the mitosis (PMID: 1730413/PMID: 18292088). 80063-1-RR is specific for ACE2, and its antigen region is 30-356aa.

Protocols

Product Specific Protocols
IHC protocol for ACE2 antibody 80063-1-RRDownload protocol
IF protocol for ACE2 antibody 80063-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...