ACE2 Recombinant monoclonal antibody, PBS Only

ACE2 Uni-rAb® Recombinant Antibody for IHC, IF-P, Indirect ELISA

Cat No. 80063-1-PBS
Clone No.4H12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF-P, Indirect ELISA

4H12, ACE related carboxypeptidase, ACEH, ACE-related carboxypeptidase, Angiotensin converting enzyme 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

80063-1-PBS targets ACE2 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30683

Product name: Recombinant human ACE2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 30-356 aa of BC048094

Sequence: DKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDF

Predict reactive species
Full Name angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Calculated Molecular Weight 805 aa, 92 kDa
GenBank Accession NumberBC048094
Gene Symbol ACE2
Gene ID (NCBI) 59272
RRIDAB_2918860
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BYF1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2. The location of ACE2 is membrane and cytoplasm, however it accumulates in the nucleus during the mitosis (PMID: 1730413/PMID: 18292088). 80063-1-RR is specific for ACE2, and its antigen region is 30-356aa.

Loading...
||
New chat

Able

正在加载,请稍候...