Home
Products
Primary Antibodies
Recombinant Antibodies
LATS1 Recombinant monoclonal antibody, PBS Only (Capture) (80613-3-PBS)

LATS1 Recombinant monoclonal antibody, PBS Only (Capture)

Name: LATS1 Recombinant monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 80613-3-PBS-100UG

LATS1 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 80613-3-PBS

Clone No.252021A3

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllSandwich ELISA sample testSandwich ELISA

Sandwich ELISA sample test of MP02921-1
The mean LATS1 concentration was determined to be 128.4 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 42.1 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load, 23.1 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load, 40.0 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 52.2 ng/mL in A431 cell extract based on a 1.2 mg/mL extract load and 72.9 ng/mL in HCT 116 cell extract based on a 1.3 mg/mL extract load.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
The mean LATS1 concentration was determined to be 128.4 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 42.1 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load, 23.1 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load, 40.0 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 52.2 ng/mL in A431 cell extract based on a 1.2 mg/mL extract load and 72.9 ng/mL in HCT 116 cell extract based on a 1.3 mg/mL extract load.
Sandwich ELISA standard curve of MP02921-1
Sandwich ELISA standard curve of MP02921-1, Human LATS1 Recombinant Matched Antibody Pair - PBS only. 80613-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag11140. 80613-2-PBS was HRP conjugated as the detection antibody. Range: 78.1-2500 pg/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

80613-3-PBS targets LATS1 as part of a matched antibody pair:

MP02921-1: 80613-3-PBS capture and 80613-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag11140 Product name: Recombinant human LATS1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-135 aa of BC015665 Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI Predict reactive species
Full Name	LATS, large tumor suppressor, homolog 1 (Drosophila)
Calculated Molecular Weight	15 kDa, 127 kDa
GenBank Accession Number	BC015665
Gene Symbol	LATS1
Gene ID (NCBI)	9113
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q6PJG3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

LATS1 Recombinant monoclonal antibody, PBS Only (Capture)

-/ -

Sandwich ELISA sample test of MP02921-1

Sandwich ELISA standard curve of MP02921-1

Product Information