Home
Products
Primary Antibodies
Recombinant Antibodies
LATS1 Recombinant monoclonal antibody, PBS Only (Detector) (80613-2-PBS)

LATS1 Recombinant monoclonal antibody, PBS Only (Detector)

Name: LATS1 Recombinant monoclonal antibody, PBS Only (Detector), 100ug
Brand: Proteintech
SKU: 80613-2-PBS-100UG

LATS1 Uni-rAb^® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 80613-2-PBS

Clone No.252021E3

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

EC:2.7.11.1, h-warts, LATS 1, Serine/threonine-protein kinase LATS1, WARTS

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBSandwich ELISA sample testSandwich ELISA

WB analysis using 80613-2-RR (same clone as 80613-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 80613-2-RR (LATS1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80613-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA sample test of MP02921-1
The mean LATS1 concentration was determined to be 128.4 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 42.1 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load, 23.1 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load, 40.0 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 52.2 ng/mL in A431 cell extract based on a 1.2 mg/mL extract load and 72.9 ng/mL in HCT 116 cell extract based on a 1.3 mg/mL extract load.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
The mean LATS1 concentration was determined to be 128.4 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 42.1 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load, 23.1 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load, 40.0 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 52.2 ng/mL in A431 cell extract based on a 1.2 mg/mL extract load and 72.9 ng/mL in HCT 116 cell extract based on a 1.3 mg/mL extract load.
Sandwich ELISA standard curve of MP02921-1
Sandwich ELISA standard curve of MP02921-1, Human LATS1 Recombinant Matched Antibody Pair - PBS only. 80613-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag11140. 80613-2-PBS was HRP conjugated as the detection antibody. Range: 78.1-2500 pg/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

80613-2-PBS targets LATS1 as part of a matched antibody pair:

MP02921-1: 80613-3-PBS capture and 80613-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag11140 Product name: Recombinant human LATS1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-135 aa of BC015665 Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI Predict reactive species
Full Name	LATS, large tumor suppressor, homolog 1 (Drosophila)
Calculated Molecular Weight	15 kDa, 127 kDa
Observed Molecular Weight	140 kDa
GenBank Accession Number	BC015665
Gene Symbol	LATS1
Gene ID (NCBI)	9113
RRID	AB_3743348
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q6PJG3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongs to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268).