Ataxin 2 Recombinant monoclonal antibody

Ataxin 2 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, IP, ELISA
Cat No. 80919-2-RR
Clone No.250888E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

ATXN2, ataxin2, Ataxin-2, ATX2, ATXN 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, Neuro-2a cells
Positive IP detected inNIH/3T3 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80919-2-RR targets Ataxin 2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16470

Product name: Recombinant human Ataxin 2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 251-600 aa of BC114546

Sequence: GSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSS

Predict reactive species
Full Name ataxin 2
Calculated Molecular Weight 1313 aa, 140 kDa
Observed Molecular Weight 140-150 kDa
GenBank Accession NumberBC114546
Gene Symbol ATXN2
Gene ID (NCBI) 6311
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99700
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATXN2 contains a repeat structure with 22 or 23 triplets coding for glutamine and the (CAG)8CAA(CAG)4CAA(CAG)8 sequence; expansion of this domain to a size ≥34 triplets with a pure CAG sequence primarily causes autosomal dominant SCA2 [PMID:18418684], while ATXN2 expansions with CAA interruptions were observed as the cause of Levo-dopa responsive Parkinson's disease [PMID:10668726]. ATXN2 expansions associated with ALS were reported to be interrupted by at least one CAA triplet [PMID:21537950]

Protocols

Product Specific Protocols
IF protocol for Ataxin 2 antibody 80919-2-RRDownload protocol
IHC protocol for Ataxin 2 antibody 80919-2-RRDownload protocol
IP protocol for Ataxin 2 antibody 80919-2-RRDownload protocol
WB protocol for Ataxin 2 antibody 80919-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...