IL-6 Recombinant monoclonal antibody, PBS Only (Capture)

IL-6 antibodies are used for both research and therapeutic purposes to detect, quantify, and block the activity of interleukin-6 (IL-6), a cytokine central to immune regulation, inflammation, hematopoiesis, and cancer biology. Proteintech has an extensive range of IL-6 antibodies validated for WB, IHC, IF/ICC, IP, Neutralization, ELISA and more.
Cat No. 81077-1-PBS
Clone No.2E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

IL6, 2E9, B-cell stimulatory factor 2, IFN-beta-2, IL 6

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81077-1-PBS targets IL-6 as part of a matched antibody pair:

MP80002-1: 81077-1-PBS capture and 68659-10-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10565

Product name: Recombinant human IL-6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-212 aa of BC015511

Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Predict reactive species
Full Name interleukin 6 (interferon, beta 2)
Calculated Molecular Weight 212 aa, 24 kDa
Observed Molecular Weight20 kDa
GenBank Accession NumberBC015511
Gene Symbol IL6
Gene ID (NCBI) 3569
ENSEMBL Gene IDENSG00000136244
RRIDAB_2918927
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05231
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...