IL-6 Recombinant monoclonal antibody

• 

  WB analysis of HUVEC using 81077-1-RR

  HUVEC cells were subjected to SDS PAGE followed by western blot with 81077-1-RR (IL-6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-87 MG using 81077-1-RR

  Protein transport inhibitor treated U-87 MG cells were subjected to SDS PAGE followed by western blot with 81077-1-RR (IL-6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 81077-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81077-1-RR against Human IL-6 were performed. The affinity constant is below 1 pM.

IL-6 antibodies are used for both research and therapeutic purposes to detect, quantify, and block the activity of interleukin-6 (IL-6), a cytokine central to immune regulation, inflammation, hematopoiesis, and cancer biology. Proteintech has an extensive range of IL-6 antibodies validated for WB, IHC, IF/ICC, IP, Neutralization, ELISA and more.

Cat No. 81077-1-RR

Clone No.2E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

IL6, Interferon beta-2, IL 6, IFN-beta-2, B-cell stimulatory factor 2

---

Tested Applications

• Positive WB detected in: HUVEC cells, Protein transport inhibitor treated U-87 MG cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81077-1-RR targets IL-6 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10565

  Product name: Recombinant human IL-6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-212 aa of BC015511

  Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

• Full Name: interleukin 6 (interferon, beta 2)
• Calculated Molecular Weight: 212 aa, 24 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC015511
• Gene Symbol: IL6
• Gene ID (NCBI): 3569
• ENSEMBL Gene ID: ENSG00000136244
• RRID: AB_2918927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05231
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.