IL-6 Recombinant monoclonal antibody

IL-6 antibodies are used for both research and therapeutic purposes to detect, quantify, and block the activity of interleukin-6 (IL-6), a cytokine central to immune regulation, inflammation, hematopoiesis, and cancer biology. Proteintech has an extensive range of IL-6 antibodies validated for WB, IHC, IF/ICC, IP, Neutralization, ELISA and more.
Cat No. 81077-1-RR
Clone No.2E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

IL6, Interferon beta-2, IL 6, IFN-beta-2, B-cell stimulatory factor 2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHUVEC cells, Protein transport inhibitor treated U-87 MG cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81077-1-RR targets IL-6 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10565

Product name: Recombinant human IL-6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-212 aa of BC015511

Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Predict reactive species
Full Name interleukin 6 (interferon, beta 2)
Calculated Molecular Weight 212 aa, 24 kDa
Observed Molecular Weight20 kDa
GenBank Accession NumberBC015511
Gene Symbol IL6
Gene ID (NCBI) 3569
ENSEMBL Gene IDENSG00000136244
RRIDAB_2918927
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05231
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 protein is secreted by a variety of cell types including T cells and macrophages as phosphorylated and variably glycosylated molecule. IL-6 plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. IL-6 is also considered a myokine, a cytokine produced from muscle, and is elevated in response to muscle contraction. IL-6 has been shown to interact with interleukin-6 receptor and glycoprotein 130. Additionally, IL-6 is involved in hematopoiesis, bone metabolism, and cancer progression, and has been defined an essential role in directing transition from innate to acquired immunity.

Protocols

Product Specific Protocols
WB protocol for IL-6 antibody 81077-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...