Tested Applications
| Positive WB detected in | mouse kidney tissue, rat kidney tissue |
| Positive IHC detected in | mouse kidney tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81137-2-RR targets AQP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14093 Product name: Recombinant human AQP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-269 aa of BC022486 Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK Predict reactive species |
| Full Name | aquaporin 1 (Colton blood group) |
| Calculated Molecular Weight | 269 aa, 29 kDa |
| Observed Molecular Weight | 25-28 kDa, 35-50 kDa |
| GenBank Accession Number | BC022486 |
| Gene Symbol | AQP1 |
| Gene ID (NCBI) | 358 |
| RRID | AB_3743368 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P29972 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AQP1 is a member of aquaporins (AQPs) that are small membrane-spanning proteins facilitating water transport. AQP1 is expressed in most tissues in the mammalian body. Alterations of AQP1 expression have been linked to variety of diseases, including cancer. The predicted molecular weight of AQP1 is around 28 kDa, while highly glycosylated form can also be observed around 35-50 kDa. (PMID:20965731,16508653, 1530176).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AQP1 antibody 81137-2-RR | Download protocol |
| IHC protocol for AQP1 antibody 81137-2-RR | Download protocol |
| WB protocol for AQP1 antibody 81137-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













