AQP1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• AQP1 Recombinant monoclonal antibody, PBS Only (81137-2-PBS)

AQP1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 81137-2-PBS

Clone No.251798B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Aquaporin 1, AQP 1, AQP-1, Aquaporin1, Aquaporin-1

• 

  WB analysis of mouse kidney using 81137-2-RR (same clone as 81137-2-PBS)

  Mouse kidney total extract lysate and membrane extract lysate were subjected to SDS PAGE followed by western blot with 81137-2-RR (AQP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81137-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat kidney using 81137-2-RR (same clone as 81137-2-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 81137-2-RR (AQP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81137-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 81137-2-RR (same clone as 81137-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 81137-2-RR (AQP1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81137-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 81137-2-RR (same clone as 81137-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 81137-2-RR (AQP1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81137-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 81137-2-RR (same clone as 81137-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 81137-2-RR (AQP1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81137-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse kidney using 81137-2-RR (same clone as 81137-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using AQP1 antibody (81137-2-RR, Clone: 251798B1 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 81137-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 81137-2-RR

  Biolayer interferometry (BLl) kinetic assays of 81137-2-RR against Human AQP1 were performed. The affinity constant is 6.13 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

81137-2-PBS targets AQP1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14093

  Product name: Recombinant human AQP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 220-269 aa of BC022486

  Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

• Full Name: aquaporin 1 (Colton blood group)
• Calculated Molecular Weight: 269 aa, 29 kDa
• Observed Molecular Weight: 25-28 kDa, 35-50 kDa
• GenBank Accession Number: BC022486
• Gene Symbol: AQP1
• Gene ID (NCBI): 358
• RRID: AB_3743368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29972
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AQP1 is a member of aquaporins (AQPs) that are small membrane-spanning proteins facilitating water transport. AQP1 is expressed in most tissues in the mammalian body. Alterations of AQP1 expression have been linked to variety of diseases, including cancer. The predicted molecular weight of AQP1 is around 28 kDa, while highly glycosylated form can also be observed around 35-50 kDa. (PMID:20965731,16508653, 1530176).