Tested Applications
| Positive WB detected in | A549 cells, HEK-293 cells |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | HepG2 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81468-5-RR targets SCD1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species |
| Full Name | stearoyl-CoA desaturase (delta-9-desaturase) |
| Calculated Molecular Weight | 355 aa, 41 kDa |
| Observed Molecular Weight | 28-42 kDa |
| GenBank Accession Number | BC005807 |
| Gene Symbol | SCD |
| Gene ID (NCBI) | 6319 |
| RRID | AB_3670496 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | O00767 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SCD1 antibody 81468-5-RR | Download protocol |
| IF protocol for SCD1 antibody 81468-5-RR | Download protocol |
| WB protocol for SCD1 antibody 81468-5-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maxence (Verified Customer) (08-27-2026) | This SCD1 works very good in IF-P. The staining is well localized in active metabolic zones in human kidney, colon cancer, and healthy colon. The IF was performed on FFPE human Kindey and Colon cancer tissue slides with Dako antigen retrival pH9. Primary incubation was performed at 1:100 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Rabbit at 1:2000 for 2h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.
 |
