×
Use Able AI chat for product recommendations

ATF4 Recombinant monoclonal antibody

ATF4 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA, ChIP-qPCR

Cat No. 81798-2-RR
Clone No. 230306B5
Publications (2)
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), ELISA, ChIP-qPCR

Synonyms

230306B5, cAMP-dependent transcription factor ATF-4, CREB2, Cyclic AMP-responsive element-binding protein 2, Tax-responsive enhancer element-binding protein 67

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using ATF4 Recombinant antibody (81798-2-RR)

    WB analysis using 81798-2-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 81798-2-RR (ATF4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using ATF4 Recombinant antibody (81798-2-RR)

    IF Staining of HeLa using 81798-2-RR

    Immunofluorescent analysis of (4% PFA) fixed Tunicamycin treated HeLa cells using ATF4 antibody (81798-2-RR, Clone: 230306B5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Flow cytometry (FC) experiment of HEK-293 cells using ATF4 Recombinant antibody (81798-2-RR)

    FC experiment of HEK-293 using 81798-2-RR

    1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug ATF4 Recombinant antibody (81798-2-RR, Clone:230306B5) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • ChIP experiment of NIH/3T3 cells using ATF4 Recombinant antibody (81798-2-RR)

    ChIP experiment of NIH/3T3 using 81798-2-RR

    Chromatin was prepared from NIH/3T3 cells treated with Tunicamycin (2ug/mll) overnight. Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 20 µg of cross-linked chromatin, 5 µg of ATF4 (81798-2-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Affinity and Kinetic Characterization of 81798-2-RR

    Affinity and Kinetic Characterization of 81798-2-RR

    Biolayer interferometry (BLl) kinetic assays of 81798-2-RR against Human ATF4 were performed. The affinity constant is below 1 pM.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Able AI
Able AI
What's the best dilution for ATF4 in ?

Tested Applications

Positive WB detected inA549 cells, HEK-293T cells
Positive IF/ICC detected inTunicamycin treated HeLa cells
Positive FC (Intra) detected inHEK-293 cells
Positive ChIP-qPCR detected inTunicamycin-NIH/3T3 (2ug/ml, overnight) NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
CHIP-QPCRCHIP-QPCR : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81798-2-RR targets ATF4 in WB, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1279

Product name: Recombinant human ATF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC022088

Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Predict reactive species
Full Name activating transcription factor 4 (tax-responsive enhancer element B67)
Calculated Molecular Weight 39 kDa
Observed Molecular Weight45-50 kDa
GenBank Accession NumberBC022088
Gene Symbol ATF4
Gene ID (NCBI) 468
RRIDAB_3670506
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18848
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATF4 is a transcription factor, that accumulates predominantly in osteoblasts, where it regulates terminal osteoblast differentiation and bone formation. As a basic leucine-zipper (bZip) transcription factor, ATF4 can regulate amino acid metabolism, cellular redox state, and anti-stress responses. It also regulates age-related and diet-induced obesity and glucose homeostasis in mammals, and has conserved metabolic functions in flies. Due to its location at chromosome 22q13, a region linked to schizophrenia, ATF4 is considered as a positional candidate gene for schizophrenia. Otherwise, since ATF4 is induced by tumour microenvironmental factors, and regulates processes relevant to cancer progression, it might serve as a potential therapeutic target in cancer.

Protocols

Product Specific Protocols
FC protocol for ATF4 antibody 81798-2-RRDownload protocol
IF protocol for ATF4 antibody 81798-2-RRDownload protocol
WB protocol for ATF4 antibody 81798-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ATF4 Recombinant monoclonal antibody (catalog no. 81798-2-RR) has 2 citations. They appear in Nature Communications (tumor metabolic adaptation and PARP1/2 vulnerability in B-cell lymphomas) and Journal of Photochemistry and Photobiology B (ROS-mediated apoptosis via mitochondrial complex I inhibition in acute myeloid leukemia). The research fields span oncology, metabolic adaptation, and apoptosis, with applications in WB for both human and mouse samples.

Automatically generated from the 2 publication citations by Able AI.
SpeciesApplicationTitle
mouseWB

Nat Commun

Tumor metabolic adaptation induced by L-asparaginase reveals a vulnerability to PARP1/2 inhibitor in B-cell lymphomas.

Authors - Anaïs Aussel
View Article
humanWB

J Photochem Photobiol B

Ultraviolet-treated riboflavin induces ROS-mediated apoptosis via inhibiting mitochondrial complex I in acute myeloid leukemia.

Authors - Ruining Liu
View Article
||
New chat

Able™

正在加载，请稍候...