CoraLite® Plus 488-conjugated ATF4 Recombinant monoclonal antibody

ATF4 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-81798-2
Clone No.230306B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

TXREB, Tax-responsive enhancer element-binding protein 67, Cyclic AMP-responsive element-binding protein 2, CREB2, cAMP-dependent transcription factor ATF-4

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inTunicamycin treated HeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81798-2 targets ATF4 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1279

Product name: Recombinant human ATF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC022088

Sequence: MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Predict reactive species
Full Name activating transcription factor 4 (tax-responsive enhancer element B67)
Calculated Molecular Weight 39 kDa
Observed Molecular Weight45-50 kDa
GenBank Accession NumberBC022088
Gene Symbol ATF4
Gene ID (NCBI) 468
RRIDAB_3673055
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP18848
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ATF4 is a transcription factor, that accumulates predominantly in osteoblasts, where it regulates terminal osteoblast differentiation and bone formation. As a basic leucine-zipper (bZip) transcription factor, ATF4 can regulate amino acid metabolism, cellular redox state, and anti-stress responses. It also regulates age-related and diet-induced obesity and glucose homeostasis in mammals, and has conserved metabolic functions in flies. Due to its location at chromosome 22q13, a region linked to schizophrenia, ATF4 is considered as a positional candidate gene for schizophrenia. Otherwise, since ATF4 is induced by tumour microenvironmental factors, and regulates processes relevant to cancer progression, it might serve as a potential therapeutic target in cancer. This antibody is a mouse monoclonal antibody raised against full length human ATF4 antigen. The antibody recognizes the 45-50 kDa ATF4 protein and its phosphorylated forms (50 kDa).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ATF4 antibody CL488-81798-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...