×
Use Able AI chat for product recommendations

CPT1A Recombinant monoclonal antibody

CPT1A Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 82012-2-RR
Clone No.251085G11

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

Carnitine O-palmitoyltransferase 1, liver isoform, Carnitine O-palmitoyltransferase I, liver isoform, CPT I, CPT1, CPT-1A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using CPT1A Recombinant monoclonal antibody (82012-2-RR)

    WB analysis using 82012-2-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 82012-2-RR (CPT1A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using CPT1A Recombinant monoclonal antibody (82012-2-RR)

    IF Staining of HeLa using 82012-2-RR

    Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CPT1A antibody (82012-2-RR, Clone: 251085G11 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Flow cytometry (FC) experiment of HeLa cells using CPT1A Recombinant monoclonal antibody (82012-2-RR)

    FC experiment of HeLa using 82012-2-RR

    1x10^6 HeLa cells were intracellularly stained with 0.25 ug CPT1A Recombinant monoclonal antibody (82012-2-RR, Clone:251085G11) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2) (red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Affinity and Kinetic Characterization of 82012-2-RR

    Affinity and Kinetic Characterization of 82012-2-RR

    Biolayer interferometry (BLl) kinetic assays of 82012-2-RR against Human CPT1A were performed. The affinity constant is 0.124 nM.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HEK-293T cells
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82012-2-RR targets CPT1A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7202

Product name: Recombinant human CPT1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 406-756 aa of BC000185

Sequence: QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETGIISQGPSSDT

Predict reactive species
Full Name carnitine palmitoyltransferase 1A (liver)
Calculated Molecular Weight 88 kDa
Observed Molecular Weight86 kDa
GenBank Accession NumberBC000185
Gene Symbol CPT1A
Gene ID (NCBI) 1374
RRIDAB_3743399
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50416
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CPT1A, also named CPT1, CPT1-L and L-CPTI, belongs to the carnitine/choline acetyltransferase family. CPT1A gene is localized Chromosome 11q13.1-2. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CPT1A is an active form of related liver-type carnitine palmitoyltransferase I (PMID: 11001805). CPT1A deficiency presents as recurrent attacks of fasting hypoketotic hypoglycemia. (PMID: 15363638). This antibody can bind the close sequences genes.

Protocols

Product Specific Protocols
FC protocol for CPT1A antibody 82012-2-RRDownload protocol
IF protocol for CPT1A antibody 82012-2-RRDownload protocol
WB protocol for CPT1A antibody 82012-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat

Able™

正在加载，请稍候...