Use Able AI chat for product recommendations

S100A8 Recombinant monoclonal antibody, PBS Only (Capture)

S100A8 Uni-rAb® Recombinant Antibody for WB, IF/ICC, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 82531-3-PBS
Clone No.242970G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

CAGA, Calgranulin A, Calgranulin-A, Calprotectin L1L subunit, CFAG

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82531-3-PBS targets S100A8 as part of a matched antibody pair:

MP80012-1: 82531-3-PBS capture and 66853-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3752

Product name: Recombinant Human S100A8 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 1-93 aa of BC005928

Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Predict reactive species
Full Name S100 calcium binding protein A8
Calculated Molecular Weight 93 aa, 11 kDa
Observed Molecular Weight 11 kDa
GenBank Accession NumberBC005928
Gene Symbol S100A8
Gene ID (NCBI) 6279
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP05109
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine.

Loading...
||
New chat

Able

正在加载,请稍候...