×
Use Able AI chat for product recommendations

Glucocorticoid receptor Recombinant monoclonal antibody

Glucocorticoid receptor Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA, ChIP-qPCR

Cat No. 82619-4-RR
Clone No. 2F22
Publications (1)
Review Product
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA, ChIP-qPCR

Synonyms

NR3C1, 2F22, GCCR, GCR, GR

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using Glucocorticoid receptor Recombinant monoclonal ant (82619-4-RR)

    WB analysis using 82619-4-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment of HepG2 cells using Glucocorticoid receptor Recombinant antibody (82619-4-RR)

    IP experiment of HepG2 using 82619-4-RR

    IP result of anti-Glucocorticoid receptor (IP:82619-4-RR, 4ug; Detection:82619-4-RR 1:8000) with HepG2 cells lysate 1920 ug.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human ovary cancer tissue using Glucocorticoid receptor Recombinant antibody (82619-4-RR)

    IHC staining of human ovary cancer using 82619-4-RR

    Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using Glucocorticoid receptor Recombinant antibody (82619-4-RR)

    IHC staining of human prostate cancer using 82619-4-RR

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:350 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human prostate cancer tissue using Glucocorticoid receptor Recombinant antibody (82619-4-RR)

    IHC staining of human prostate cancer using 82619-4-RR

    Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:350 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human ovary cancer tissue using Glucocorticoid receptor Recombinant antibody (82619-4-RR)

    IHC staining of human ovary cancer using 82619-4-RR

    Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 82619-4-RR (Glucocorticoid receptor antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using Glucocorticoid receptor Recombinant antibody (82619-4-RR)

    IF Staining of HepG2 using 82619-4-RR

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Glucocorticoid receptor antibody (82619-4-RR, Clone: 2F22 ) at dilution of 1:1000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • ChIP experiment of A549 cells using Glucocorticoid receptor Recombinant monoclonal ant (82619-4-RR)

    ChIP experiment of A549 using 82619-4-RR

    Chromatin was prepared from A549 cells that were cultured in media with 5% charcoal-stripped FBS for 3 d and then treated with dexamethasone (100 nM, 1 h). Cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 15 µg of cross-linked chromatin, 5 µg of Glucocorticoid receptor (82619-4-RR) or 5 ug of Normal Rabbit IgG (98136-1-RR), and 20 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real-time PCR.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Affinity and Kinetic Characterization of 82619-4-RR

    Affinity and Kinetic Characterization of 82619-4-RR

    Biolayer interferometry (BLl) kinetic assays of 82619-4-RR against Human Glucocorticoid receptor were performed. The affinity constant is 0.693 nM.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Able AI
Able AI
What's the best dilution for Glucocorticoid receptor in ?

Tested Applications

Positive WB detected inHeLa cells, A549 cells, U-251 cells, DU 145 cells, MCF-7 cells, L-929 cells, RAW 264.7 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman prostate cancer tissue, human ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive ChIP-qPCR detected indexamethasone (100 nM, 1 h) A549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:175-1:700
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
CHIP-QPCRCHIP-QPCR : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82619-4-RR targets Glucocorticoid receptor in WB, IHC, IF/ICC, IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21146

Product name: Recombinant human Glucocorticoid receptor protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC015610

Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI

Predict reactive species
Full Name nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Calculated Molecular Weight 86 kDa
Observed Molecular Weight 94-97 kDa
GenBank Accession NumberBC015610
Gene Symbol Glucocorticoid receptor
Gene ID (NCBI) 2908
RRIDAB_3086492
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04150
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058).

Protocols

Product Specific Protocols
IF protocol for Glucocorticoid receptor antibody 82619-4-RRDownload protocol
IHC protocol for Glucocorticoid receptor antibody 82619-4-RRDownload protocol
IP protocol for Glucocorticoid receptor antibody 82619-4-RRDownload protocol
WB protocol for Glucocorticoid receptor antibody 82619-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Glucocorticoid receptor Recombinant monoclonal antibody (2F22), catalog number 82619-4-RR, has 1 total citation. It appears in Phytomedicine (IF 11.3), published in December 2025. The cited study investigated how ginsenoside Rb1 alleviates atherosclerosis by modulating vascular smooth muscle cell proliferation, foam cell formation, and autophagy, using WB in mouse and rat samples. The associated research field is cardiovascular disease/atherosclerosis and cellular autophagy.

Automatically generated from the 1 publication citations by Able AI.
SpeciesApplicationTitle
mouse,ratWB

Phytomedicine

Ginsenoside Rb1 alleviates atherosclerosis by modulating vascular smooth muscle cell proliferation, foam cell formation, and autophagy.

Authors - Huan-Huan Yuan
View Article
||
New chat

Able™

正在加载，请稍候...