Use Able AI chat for product recommendations

Mouse FGF-21 Recombinant monoclonal antibody, PBS Only (Detector)

FGF-21 Uni-rAb® Recombinant Antibody for IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 82706-6-PBS
Clone No.240221D10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF/ICC, Cytometric bead array, Indirect ELISA

Fgf21, 240221D10, fibroblast growth factor 21

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82706-6-PBS targets FGF-21 as part of a matched antibody pair:

MP00366-1: 82706-5-PBS capture and 82706-6-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0259

Product name: Recombinant mouse FGF-21 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 29-210 aa of NM_020013

Sequence: AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

Predict reactive species
Full Name fibroblast growth factor 21
Calculated Molecular Weight23kd
GenBank Accession NumberNM_020013
Gene Symbol FGF-21
Gene ID (NCBI) 56636
RRIDAB_3670534
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9JJN1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Fibroblast growth factor 21 (FGF21), a member of the FGF superfamily, has emerged as an important metabolic regulator. FGF21 is produced in the liver, adipocytes and skeletal muscle and regulates glucose, energy and lipid metabolism. FGF21 is a stress-responsive hepatokine which is induced in the liver as a response to injury, regeneration, hepatocarcinogenesis and during kidney dysfunction. FGF21 is primarily metabolized in the kidney and renal secretion is the major route of FGF21 elimination. Its plasma levels increase according to the decline in renal function in patients with chronic and acute renal dysfunction.

Loading...
||
New chat

Able

正在加载,请稍候...