CHRNA7 Recombinant monoclonal antibody

CHRNA7 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 82848-4-RR
Clone No.240117D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

Neuronal acetylcholine receptor subunit alpha-7, NACHRA7, CHRNA7 2, 240117D12

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat brain tissue, mouse brain tissue
Positive FC (Intra) detected inSH-SY5Y cells, Jurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82848-4-RR targets CHRNA7 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15980

Product name: Recombinant human CHRNA7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 130-321 aa of BC037571

Sequence: TVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA

Predict reactive species
Full Name cholinergic receptor, nicotinic, alpha 7
Calculated Molecular Weight 502 aa, 56 kDa
Observed Molecular Weight50 kDa, 56 kDa
GenBank Accession NumberBC037571
Gene Symbol CHRNA7
Gene ID (NCBI) 1139
RRIDAB_3670575
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP36544
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nicotinic acetylcholine receptors (nAChRs) are cholinergic receptors that form ligand-gated ion channels that mediate fast signal transmission at synapses. CHRNA7 (neuronal acetylcholine receptor subunit alpha-7) forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. CHRNA7, so that like CHRNA7, the epithelial CHRFAM7A ORF encodes a protein (48 kDa) that differs from the CHRNA7 (58 kDa) by a distinct amino terminus and molecular weight.(PMID: 25473097)

Protocols

Product Specific Protocols
WB protocol for CHRNA7 antibody 82848-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...