BMPR1A Recombinant monoclonal antibody

BMPR1A Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, ELISA
Cat No. 82928-1-RR
Clone No.230137B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), IP, ELISA

ALK3, ALK 3, ACVRLK3, Activin receptor-like kinase 3, Activin receptor like kinase 3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, U2OS cells, HEK-293 cells, mouse heart tissue
Positive IP detected inHEK-293 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82928-1-RR targets BMPR1A in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3410

Product name: Recombinant human BMPR1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 174-427 aa of BC028383

Sequence: FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIM

Predict reactive species
Full Name bone morphogenetic protein receptor, type IA
Calculated Molecular Weight 532 aa, 60 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC028383
Gene Symbol BMPR1A
Gene ID (NCBI) 657
RRIDAB_3670667
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP36894
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BMPR1A (Bone morphogenetic protein receptor type-1A) is also named as ACVRLK3, ALK3 and SKR5. BMPR1A is an essential receptor for BMP signaling (PMID: 26279380). BMPR1A is necessary for chondrogenesis and osteogenesis (PMID: 32764110). BMPR1A is a cell surface marker of human SuSCs (PMID: 33658353).

Protocols

Product Specific Protocols
WB protocol for BMPR1A antibody 82928-1-RRDownload protocol
IP protocol for BMPR1A antibody 82928-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...