• Featured Product
  • KD/KO Validated

KHSRP Recombinant monoclonal antibody

KHSRP Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 82931-3-RR
Clone No.230189B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

230189B2, Far upstream element-binding protein 2, FBP2, FUBP2, FUSE-binding protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293T cells, Jurkat cells, mouse spleen tissue, mouse brain tissue, rat brain tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82931-3-RR targets KHSRP in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33890

Product name: Recombinant human KHSRP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 600-710 aa of NM_003685

Sequence: APPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ

Predict reactive species
Full Name KH-type splicing regulatory protein
Calculated Molecular Weight73 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberNM_003685
Gene Symbol KHSRP
Gene ID (NCBI) 8570
RRIDAB_3670671
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92945
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KHSRP, also named as FUBP2, KSRP, and p75, belongs to the KHSRP family. It binds to the dendritic targeting element and may play a role in mRNA trafficking. KHSRP is a part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. It mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. KHSRP may interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. It is involved in the degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs.

Protocols

Product Specific Protocols
IF protocol for KHSRP antibody 82931-3-RRDownload protocol
IHC protocol for KHSRP antibody 82931-3-RRDownload protocol
IP protocol for KHSRP antibody 82931-3-RRDownload protocol
WB protocol for KHSRP antibody 82931-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...