KHSRP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82931-3-RR (same clone as 82931-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82931-3-RR (KHSRP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82931-3-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 82931-3-RR (same clone as 82931-3-PBS)

  WB result of KHSRP antibody (82931-3-RR; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KHSRP transfected HeLa cells. This data was developed using the same antibody clone with 82931-3-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 82931-3-RR (same clone as 82931-3-PBS)

  IP result of anti-KHSRP (IP:82931-3-RR, 4ug; Detection:82931-3-RR 1:2500) with HeLa cells lysate 1050 ug. This data was developed using the same antibody clone with 82931-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 82931-3-RR (same clone as 82931-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 82931-3-RR (KHSRP antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82931-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 82931-3-RR (same clone as 82931-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using KHSRP antibody (82931-3-RR, Clone: 230189B2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82931-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82931-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82931-3-RR against Human KHSRP were performed. The affinity constant is 0.991 nM.

• Featured Product
• KD/KO Validated

KHSRP Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 82931-3-PBS

Clone No.230189B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

230189B2, Far upstream element-binding protein 2, FBP2, FUBP2, FUSE-binding protein 2

---

Product Information

82931-3-PBS targets KHSRP in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33890

  Product name: Recombinant human KHSRP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 600-710 aa of NM_003685

  Sequence: APPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ

• Full Name: KH-type splicing regulatory protein
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: NM_003685
• Gene Symbol: KHSRP
• Gene ID (NCBI): 8570
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92945
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KHSRP, also named as FUBP2, KSRP, and p75, belongs to the KHSRP family. It binds to the dendritic targeting element and may play a role in mRNA trafficking. KHSRP is a part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. It mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. KHSRP may interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. It is involved in the degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs.