LAMP5 Recombinant monoclonal antibody, PBS Only (Detector)

LAMP5 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 82992-2-PBS
Clone No.230102F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

C20orf103, 230102F12, BAD-LAMP, Brain and dendritic cell-associated LAMP, Brain-associated LAMP-like protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82992-2-PBS targets LAMP5 as part of a matched antibody pair:

MP00069-3: 82992-4-PBS capture and 82992-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag33894

Product name: Recombinant human LAMP5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 30-235 aa of BC050727

Sequence: EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEE

Predict reactive species
Full Name chromosome 20 open reading frame 103
Observed Molecular Weight 31-35 kDa
GenBank Accession NumberBC050727
Gene Symbol LAMP5
Gene ID (NCBI) 24141
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UJQ1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LAMP5 (Lysosome-associated membrane glycoprotein 5) is also named as BAD-LAMP and C20orf103. BAD-LAMP is a novel biomarker of nonactivated human plasmacytoid dendritic cells (PMID: 21642595). LAMP5 may be one of the key genes in the development of Multiple myeloma (MM) as well as its recurrence  (PMID: 37033323). LAMP5 is a mammalian ortholog of the Caenorhabditis elegans protein, UNC-46, which functions as a sorting factor to localize the vesicular GABA transporter UNC-47 to synaptic vesicles (PMID: 30867010). It was localized exclusively in inhibitory synaptic terminals (PMID: 30867010).

Loading...
||
New chat Able
正在加载,请稍候...