Use Able AI chat for product recommendations

FDFT1 Recombinant monoclonal antibody, PBS Only (Capture)

FDFT1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 83020-2-PBS
Clone No.230362F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

230362F3, DGPT, EC:2.5.1.21, ERG9, Farnesyl-diphosphate farnesyltransferase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83020-2-PBS targets FDFT1 as part of a matched antibody pair:

MP00097-1: 83020-2-PBS capture and 83020-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3743

Product name: Recombinant human SQS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-358 aa of BC029641

Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSK

Predict reactive species
Full Name farnesyl-diphosphate farnesyltransferase 1
Calculated Molecular Weight 417 aa, 48 kDa
GenBank Accession NumberBC029641
Gene Symbol FDFT1
Gene ID (NCBI) 2222
RRIDAB_3670762
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP37268
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SQS (Squalene synthase), also known as Farnesyl-diphosphate farnesyltransferase 1 (FDFT1) is a gene that encodes the membrane-associated enzyme squalene synthase, which is the first specific enzyme in cholesterol biosynthesis. FDFT1 is highly expressed in liver, lung, prostate, breast, ovary, bladder, cervix, thyroid, and esophageal cancers, while in colorectal, colon, testicular, uterine, pancreas, and kidney tumors, its expression is downregulated (PMID: 35093030). FDFT1 is a key downstream target of the fasting response and may be involved in CRC cell glucose metabolism (PMID: 32313017).

Loading...
||
New chat

Able

正在加载,请稍候...